Diffuse panbronchiolitis critical region protein 1 (DPCR1) Rabbit Polyclonal Antibody TA342095 from OriGene Technologies | Biocompare.com

Supplier Images

Diffuse panbronchiolitis critical region protein 1 (DPCR1) Rabbit Polyclonal Antibody

Be the first to write a review!

Supplier Page from
OriGene Technologies for
Diffuse panbronchiolitis critical region protein 1 (DPCR1) Rabbit Polyclonal Antibody

OriGene Technologies' Diffuse panbronchiolitis critical region protein 1 (DPCR1) Rabbit Polyclonal Antibody is a Rabbit Polyclonal antibody. This antibody has been shown to work in applications such as: Western Blot.

Description

Rabbit Polyclonal Anti-DPCR1 Antibody

Product Specs
ItemDiffuse panbronchiolitis critical region protein 1 (DPCR1) Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price Pricing Info Supplier Page View Company Product Page
Catalog NumberTA342095
Quantity100 µl
ApplicationsWB
Concentrationlot specific
Conjugate/TagUnconjugated
ReactivityHuman
TargetMUCL3
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for anti-DPCR1 antibody: synthetic peptide directed towards the C terminal of human DPCR1. Synthetic peptide located within the following region: SHLNKTEVTHQVPTGSFTLITSRTKLSSITSEATGNESHPYLNKDGSQKG
NCBI Full Gene Namemucin like 3
NCBI Gene AliasesDPCR1, PBLT, C6orf37
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!